PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G021200.1
Common NamePHAVU_002G021200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family LBD
Protein Properties Length: 300aa    MW: 32766.8 Da    PI: 6.8368
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G021200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601376.7e-4381071100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk lrrkC+++Cv+apyfp ++p++fa+vhk+FGasnv kll++l+ ++r+da++sl+yeAear+rdPvyG+vg+i+ lq++l+q +
  Phvul.002G021200.1   8 PCAACKCLRRKCTQECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELSASQRDDAVKSLAYEAEARLRDPVYGCVGLISVLQHKLRQIQ 98 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          el+ +k+e
  Phvul.002G021200.1  99 MELNNAKKE 107
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.537108IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-428105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MSSSSNSPCA ACKCLRRKCT QECVFAPYFP PDNPQRFAYV HKVFGASNVA KLLNELSASQ  60
RDDAVKSLAY EAEARLRDPV YGCVGLISVL QHKLRQIQME LNNAKKELAT YIGPQAFQGL  120
PAPILQQQPN NLFSGSLYGN MAGVTAATHG GQLVIREAQS PQQHQILEAQ QLAAAVAARE  180
QQEMFRSYEH QQQQEFLRFS GGFDVGSASA GGFSQISPVA ASADQLSPSL ALGSFDNAYH  240
MQQPQVAEPH PHPHNIPFEA QLLLPPQQKQ TQQQTQQSQL PLHQPQSESE ECRSLGPTC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156831.10.0hypothetical protein PHAVU_002G021200g
SwissprotQ9FKZ38e-75LBD36_ARATH; LOB domain-containing protein 36
TrEMBLV7CHR20.0V7CHR2_PHAVU; Uncharacterized protein
STRINGGLYMA11G06210.21e-158(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-72ASYMMETRIC LEAVES 2-like 1